SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pa_6_920|chrm6_SC2|Putative from Podospora anserina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pa_6_920|chrm6_SC2|Putative
Domain Number 1 Region: 12-104
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000118
Family Ankyrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pa_6_920|chrm6_SC2|Putative
Sequence length 208
Comment Protein similar to YCR051W of Saccharomyces cerevisiae
Sequence
MSPNPYLLAADNPQALLELLRENPSIAVCQDEHGYSLVHAAASYNHFDLLRSLINEFKVP
VDIKDEDGETALFVVETVEAARILVEELKLDTKITNDEGQTAREKIEAEEEFPEVAEYLA
GLEGANGVANGTELPPAPQGLRVTVGTMDEAEAGEQQPDPEFRRRIEELAARDDIHTPEG
QAALRQLVEEAIGGEGLAEERSVRPRQD
Download sequence
Identical sequences B2B365
Pa_6_920|chrm6_SC2|Putative XP_001910416.1.27508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]