SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407722735|ref|YP_006842396.1|NC_018701 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407722735|ref|YP_006842396.1|NC_018701
Domain Number 1 Region: 144-375
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 8.01e-66
Family CAT-like 0.0000151
Further Details:      
 
Domain Number 2 Region: 14-92
Classification Level Classification E-value
Superfamily Single hybrid motif 1.07e-19
Family Biotinyl/lipoyl-carrier proteins and domains 0.00079
Further Details:      
 
Domain Number 3 Region: 84-125
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.000000000144
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407722735|ref|YP_006842396.1|NC_018701
Sequence length 378
Comment dihydrolipoyllysine-residue succinyltransferase [Sinorhizobium meliloti Rm41 plasmid pSYMB]
Sequence
MGGLIDIQAPLEQEGTKAVVRNWLRKIGDPVKSGDPLVELETDKVTQEVSAPADGVLAEI
LMRNGDDATPGAVLGRIGSEAAGAGHAPHYSPAVRHAAEEYGLDPATVTGTGRGGRVTRA
DMDRAFTARQEGPASVAAEAGDRGAAPKSRRIPHSGMRAAIAEHMLNSVTTAPHVTAVFE
ADFSAVMRHRDEHGKRLAADGTKLSYTAYVVSACVAAMRAVPEVNSRWHEDALETFDDIN
IGVGISLGDKGLVVPVIHRAQDLSLAEIAARLQDLTTRARSSALSRADVTGGTFTISNHG
ASGSLLAAPIIINQPQSAILGVGKLDKRVIVREVDGADTIQIRPMAYVSLTIDHRALDGH
QTNAWLTHFVRVIETWPK
Download sequence
Identical sequences gi|407722735|ref|YP_006842396.1|NC_018701 WP_015008066.1.3038 WP_015008066.1.34728 WP_015008066.1.36834 WP_015008066.1.96031 gi|407722735|ref|YP_006842396.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]