SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470185393|ref|YP_007612765.1|NC_020560 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470185393|ref|YP_007612765.1|NC_020560
Domain Number 1 Region: 144-375
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.25e-66
Family CAT-like 0.0000151
Further Details:      
 
Domain Number 2 Region: 14-92
Classification Level Classification E-value
Superfamily Single hybrid motif 1.06e-19
Family Biotinyl/lipoyl-carrier proteins and domains 0.00079
Further Details:      
 
Domain Number 3 Region: 84-125
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.000000000144
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470185393|ref|YP_007612765.1|NC_020560
Sequence length 378
Comment Dihydrolipoyllysine-residue succinyltransferase [Sinorhizobium meliloti 2011 plasmid pSymB]
Sequence
MGGFIDIQAPLEQEGTKAVVRNWLRKIGDPVKSGDPLVELETDKVTQEVSAPADGVLAEI
LMRNGDDATPGAVLGRIGSEAAGAGHAPHYSPAVRHAAEEYGLDPATVTGTGRGGRVTRA
DMDRAFTARQEGPASVAAEAGDRGAAPKSRRIPHSGMRAAIAEHMLNSVTTAPHVTAVFE
ADFSAVMRHRDEHGKRLAADGTKLSYTAYVVSACVAAMRAVPEVNSRWHEDALETFDDIN
IGVGISLGDKGLVVPVIHRAQDLSLAEIAARLQDLTTRARSNALSRADVTGGTFTISNHG
ASGSLLAAPIIINQPQSAILGVGKLDKRVIVREVDGADTIQIRPMAYVSLTIDHRALDGH
QTNAWLTHFVRVIETWPK
Download sequence
Identical sequences Q92XE0
266834.SM_b20019 NP_436562.1.96377 WP_010974946.1.4234 WP_010974946.1.787 WP_010974946.1.92524 gi|16263770|ref|NP_436562.1| gi|433610293|ref|YP_007193754.1| gi|470185393|ref|YP_007612765.1| gi|16263770|ref|NP_436562.1|NC_003078 gi|433610293|ref|YP_007193754.1|NC_019849 gi|470185393|ref|YP_007612765.1|NC_020560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]