SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8LNX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8LNX4
Domain Number 1 Region: 164-396
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.54e-35
Family Hypothetical protein VC1974 0.087
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily Single hybrid motif 2.62e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.001
Further Details:      
 
Domain Number 3 Region: 107-149
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.000000000602
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8LNX4
Sequence length 398
Comment (tr|A8LNX4|A8LNX4_DINSH) Dihydrolipoamide acetyltransferase {ECO:0000313|EMBL:ABV92282.1} KW=Complete proteome; Reference proteome OX=398580 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12). GN=Dshi_0536 OC=Rhodobacteraceae; Dinoroseobacter.
Sequence
MPRLGETMEEATIADWLVQPGQSFKRGDPLLEVETDKTMVEYPALGDGILVETLVGPGDV
VEVGTPIAVIETRDAWDSVEEPDAAASSPGAAPSEVAGTAAQALVSPDAARLRATPLARR
IARENHIALSQVTGTGRRGRIEAGDVRVMLTEGASTPAVIQAAPGATASVYCVHGFAGLG
SNWAALRASLQRAGITSSAPDLPGHGRNRVDAGSIEALADWLAADLASQPEPVQLVGHSL
GAHVAARAAQRVPSRVARLTLLAPAGCGIEINGAFLSGMAAAPSVGELAHLMRLLGRKAA
ELDNHALEALSRELQGDRLSALAAAAARADVQRIDTIAPLRSLAGKIPVRAIFGLSDQII
PRDHAFHLPPAVACHMLEAGHMPHWDATEEVASIIAAP
Download sequence
Identical sequences A8LNX4
398580.Dshi_0536 gi|159043089|ref|YP_001531883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]