SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0PDA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0PDA4
Domain Number 1 Region: 91-168
Classification Level Classification E-value
Superfamily T-antigen specific domain-like 1.7e-30
Family T-antigen specific domain-like 0.0000338
Further Details:      
 
Domain Number 2 Region: 5-84
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.96e-19
Family Chaperone J-domain 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0PDA4
Sequence length 172
Comment (tr|Q0PDA4|Q0PDA4_POVBK) small T {ECO:0000313|EMBL:BAF03019.1, ECO:0000313|EMBL:BAG75159.1} KW=Complete proteome OX=1891762 OS=BK polyomavirus (BKPyV) (Human polyomavirus 1). GN= OC=Viruses; dsDNA viruses, no RNA stage; Polyomaviridae. OH=9606
Sequence
MDKVLNREESMELMDLLGLERAAWGNLPLMRKAYLKKCKEFHPDKGGDEDKMKRMNTLYK
KMEQDVKVAHQPDFGTWNSSEVCADFPLCPDTLYCKEWPICSKKPSVHCPCMLCQLRLRH
LNRKFLRKEPLVWIDCYCIDCFTQWFGLDLTEETLQWWVQIIGETPFRDLKL
Download sequence
Identical sequences P15000 Q0PDA4
Q0PDA4_POVBK ST_POVBA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]