SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000002975 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000002975
Domain Number 1 Region: 223-406
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.81e-49
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 99-192
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000000811
Family WWE domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000002975   Gene: ENSFALG00000002858   Transcript: ENSFALT00000002988
Sequence length 454
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603326.1:1610097:1624661:-1 gene:ENSFALG00000002858 transcript:ENSFALT00000002988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKKDSSSDEASKDNKKDNCDEICLFYVWKYCKNKDKCKSVHYHLPYKWEIHDGLFWHELS
MMEEIEKAYCDPKNSSLQSKNINFQTMTCSSSLVRRLSTPSSVTKPTFLLTTQWIWYWKN
NQDKWIEYGEQEEGNSVTAPSSAIIENLYQADPCAIVPFQAGQHQYELNFKEMTQTNITF
KTKRQVCRRPKFVSSEDVQKIKTGSQRDSSIPSHWDASALPDLGYKAVVISNATPEYNEI
KQLFHQTMKNYSILKILRIQNPSLWKVFQWQKEKMKRENGGKEVQEKLLFHGTDITSMKT
ICTQNFDWRICGSNGTNYGKGSYFARDACYSHAYCQATLQGYLMFVARVLVGDYVKGNAA
YVRPPKKCADKLWFYDSCVDNELNPSVFVVFEKHQIYPEYIVEYKEERIREQKEPAIIVY
KAVGIRQQKEAEIRVCKEDGIREHKEEKSKCVIS
Download sequence
Identical sequences U3JJM1
ENSFALP00000002975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]