SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000010651 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000010651
Domain Number 1 Region: 1234-1507
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-57
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 246-508,537-602
Classification Level Classification E-value
Superfamily L domain-like 6.12e-42
Family Leucine rich effector protein YopM 0.042
Further Details:      
 
Domain Number 3 Region: 50-209
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.44e-17
Family Ankyrin repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 625-816
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.95e-16
Family G proteins 0.0094
Further Details:      
 
Domain Number 5 Region: 1575-1650,1678-1776
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000305
Family Cell cycle arrest protein BUB3 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000010651   Gene: ENSFALG00000010215   Transcript: ENSFALT00000010693
Sequence length 1999
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603210.1:2790565:2864521:-1 gene:ENSFALG00000010215 transcript:ENSFALT00000010693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWCVGTEESAVCRESNMDPQNGTVDMGGKQSTSGDVSVIQTPVTESIQDAYKAGDTSKA
QELIRLSCEETALQVEKCQLLGIAAAYGDLQAVRYLLKEALVVLPTEPSDDNAAVVAAYF
GHKDIVKELLDSLRGPNTCQQLLNWMLAIACQQGHLDIVKLLIRAYSADPESCAVRKNEF
PVLIRLPLYAAIKAGNEDVAVFLLRNGAFFCSYILMDSPESSKHLLRKYFIETTPLPGSA
PPKTALCVNWSNLKLPWVDLDWLIDISCQITELDLSANCLVSLPSVIPWGLINLRRLSLA
DNQLTELPSVQSSDEIICTRLLEVDVSSNRLSTLPTGFLHLKNLKKLIASKNYMEKLFDE
ENTTNWIGLRKLQEFDVSDNRLVELPTVFLYCFKSLNILNVSRNQLKVFPDPWACPLKCC
KASRNALEFLPDALTVFWKNHLREVDFSENSLKEVPAGLFQLEALVSLKLLGNQLVTLPS
QDKWNCKQLKSLDLSKNQLGKNDEGFKTKRIPFFTTKNRVRGGPEAGPFLEFPAFLSDSL
EVLYLNDNQLDSVPQSVCLLKGLTELYLGNNPGIRELPPELGQLANLWQLDIEELNISNV
PAEIRKEGPKTVLAYLRAQLRRAEKCKLMKMIVIGPPRQGKSTLVEILQTGKVPQVMHSD
ATIRTTKWELPKPVGHKAKVDSVEFNVWDIGGPASMSTVNQCFFTDKALYIVVWNLALGE
EAVANLQFWLLNIEAKAPNSVVLVVGTHLDLIETKFRVERIATLRAYVLALCRSPSGSRA
TGFPDITFKHLHELSCKTLEGLEGLRQLIFHVTCNMKDVGSSICSQKLAGRLIPRSYLSL
QEAVLAEQHRRSQNDDVQYLTDRQIELMIEQTPGNDIKDYEDLQTAINFLIETGTLLHFP
DTSHGLRNLYFLDPVWLSECLQRIFNIKSSRSVAKNGVIRAEDLRMLLVGTGFTEQTEEQ
YFQFLAKFEIALPVANNSYLLPHLLPTKPALDIHGLCHQTANTVQRVFKMSFVPVGFWQR
FIARMLISLAEMDLQLFENKKNTKTRNKKVTIYSFTGTQRNRCSTFRVKRTHTVYWQEGL
FVTFDGGYLSVESSDVNWKKKKSGGIKIISQSEVRDFSAMAFITDHVNSLIDQWFPALTA
TESDGTLLMEQYVPCHICAAARPEQSEGGERAEDVQYFNMEDCVLTAIELDYITCPNHPD
IPVSLQELVPELFMTDFPARLFLENSKLECSENENNVLGQGGSGTVIYRARYQGKPVAVK
RFQIKKCKGSPTSAADTMLKHLRAMDAMKNFSEFRQEASMLHSLQHPCIVSLIGISIHPL
CFALELAPLGSLTTVLAENSKGSSFVPLGHMLTHKIAYQIATGLAYLHKKNIIFCDLKSD
NILVWSLDVREHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIVYDEKVDMFSY
GMVLYELLSGQRPVLGHHQLQIAKKLSKGIRPVLGQPEEVQLYRMQALMMECWDTKPEKR
PLATSVVGQMKDPTFATFMYLLPCGKQSSFFCSLGQEYTVVFWDGKEDTRNYTVVNLEKG
VMEVQRMSCPGMKLCCQLKFQNALWAATEDQKISVYGLQGMCPLKTPLKGLDTPATVSCF
LVMPLVKRNSYMVLAGLSDGLVAVYSVSQGLPGDSCSYLCSHTANRSKFHISDDDPRQNP
YPVRAMEAANSGAEVWYSNGPGLLVIDCACLEISRRLEPFSPPACVASIACTSECHGEEV
VWCLDDRSNFLVMFHATSYQLCARYFCGDCSPLRDMFTIQQPSAAIPATAPLGHGAVESS
PPGDMSIMYSPDVGTQILNHQDSLTDYCSVSSYSSSPPNTVTRCPSSLPSSPMSSSSAPF
STDFEESEKFHELKAPLDHDASPVGDNTEHLQAVKILPVKDLIWIPRRGGDIIVIGLEKE
SGTQRGRVMAVLKAGELAPYGTLVDAALVAKDTVVCCFENEHTERCLAVWRGWSARDFDI
FYQAYEELGRLETCMRKRR
Download sequence
Identical sequences U3K6J7
XP_016156475.1.66865 ENSFALP00000010651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]