SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Ficedula albicollis 76_1.0 > ENSFALP00000010716

Domain assignment for ENSFALP00000010716 from Ficedula albicollis 76_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSFALP00000010716
Domain Number 1	Region: 18-255
Classification Level	Classification	E-value
Superfamily	Ankyrin repeat	2.04e-58
Family	Ankyrin repeat	0.0000828
Further Details:

Domain Number 2	Region: 269-313
Classification Level	Classification	E-value
Superfamily	SOCS box-like	0.0000000471
Family	SOCS box-like	0.0039
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSFALP00000010716 Gene: ENSFALG00000010273 Transcript: ENSFALT00000010759
Sequence length	318
Comment	pep:known_by_projection scaffold:FicAlb_1.4:JH603210.1:2983547:3009498:-1 gene:ENSFALG00000010273 transcript:ENSFALT00000010759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKE RCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESDYRSDIINAKSNDGWTP LHVAAHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAIIRERSSCVKILLDHNANIDIQN GFLLRYAVIKSNHSYCRMFLQRGADTNLGRLEDGQTPLHLSALRDDVLCAQMLYNYGADT NTRNYEGQTPLAVSISISGSSRPCLDFLQEVTRQPRNLQDLCRIKIRQCIGLQNLKLLDE LPIAKVMKDYLKHKFDDI
Download sequence
Identical sequences	A0A091EA52 A0A091MQ34 A0A093PXL9 A0A218V081 H0ZEU9 U3K6R2 XP_002199941.1.42559 XP_005051793.1.66865 XP_005424284.1.5688 XP_005483524.1.73095 XP_008635945.1.15636 XP_008932688.1.51550 XP_008932688.1.96775 XP_009070446.1.14518 XP_009088286.1.15306 XP_010389285.1.2935 XP_010389286.1.2935 XP_014106835.1.90289 XP_015494885.1.82291 XP_017592054.1.15636 XP_017660724.1.3805 XP_017660725.1.3805 XP_017660726.1.3805 XP_017660727.1.3805 XP_017660728.1.3805 XP_017660729.1.3805 XP_017925250.1.51550 XP_021408278.1.53032 ENSTGUP00000009111 ENSTGUP00000009111 ENSFALP00000010716 59729.ENSTGUP00000009111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]