SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Ficedula albicollis 76_1.0 > ENSFALP00000012193

Domain assignment for ENSFALP00000012193 from Ficedula albicollis 76_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSFALP00000012193
Domain Number 1	Region: 8-213
Classification Level	Classification	E-value
Superfamily	Ankyrin repeat	2.7e-59
Family	Ankyrin repeat	0.00013
Further Details:

Domain Number 2	Region: 225-267
Classification Level	Classification	E-value
Superfamily	SOCS box-like	0.00000497
Family	SOCS box-like	0.0063
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSFALP00000012193 Gene: ENSFALG00000011684 Transcript: ENSFALT00000012243
Sequence length	268
Comment	pep:known_by_projection scaffold:FicAlb_1.4:JH603292.1:139630:152250:1 gene:ENSFALG00000011684 transcript:ENSFALT00000012243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MLSKGFWADRTPVHEAARSGEIVQLRQLIESGACVNAVTYDSITPLHEASLRGQAQCVKL LLDAGAQVDARNIDGSTPLCDACASGSIECVKVLLSHGAKVNPPLYTASPLHEACMNGSS ECVQLLIDVGANLEAHDCHFGTPLHVACAREHLDCAKLLLQAGANVNAAKLHETALHHAA KVRNAALVELLVQFGGNIYARDNRGKKPSDYSWSSSATARCLEYYEKTPLSLAQLCRLSV RRAAGHRGLDKISRLQIPPRLIQYLSYN
Download sequence
Identical sequences	U3KAY9 XP_005039053.1.66865 ENSFALP00000012193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]