SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Ficedula albicollis 76_1.0 > ENSFALP00000007414

Domain assignment for ENSFALP00000007414 from Ficedula albicollis 76_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSFALP00000007414
Domain Number 1	Region: 8-245
Classification Level	Classification	E-value
Superfamily	WD40 repeat-like	1.69e-59
Family	WD40-repeat	0.00032
Further Details:

Domain Number 2	Region: 240-286
Classification Level	Classification	E-value
Superfamily	SOCS box-like	0.00000000772
Family	SOCS box-like	0.0048
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSFALP00000007414 Gene: ENSFALG00000007105 Transcript: ENSFALT00000007446
Sequence length	287
Comment	pep:known_by_projection scaffold:FicAlb_1.4:JH603179.1:1765976:1772058:1 gene:ENSFALG00000007105 transcript:ENSFALT00000007446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MGLPCLVLATGLNDGQIKVWEVQTGHLLFSLLGHQDVVRDLSFAPNGSPILVSASRDKTL RVWDLSRDGRQVQVLSGHVQWVYCCSISPDCSMLCSAAGEKSALLWSMRSYTLIRRLEGH QSSVVSCDFSPDSALLVTASYDACVIMWDPYTGEQLRTLRHVPLYSMLDSSSEIHTSSLR SVCFSPEGLYLATVADDRLLRIWALELRSPVAFAPMTNGLCCMYFPHGGFIATGTRDGHV QFWTAPRVLSSLKHLCRKALRTFLTTYQVLALPIPRKLKEFLTYRTF
Download sequence
Identical sequences	U3JXB0 ENSFALP00000007414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]